| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxysterols receptor LXR-alpha [197-447] |
|---|
| Ligand | BDBM19992 |
|---|
| Substrate/Competitor | BDBM19993 |
|---|
| Meas. Tech. | LXR Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Hu, B; Collini, M; Unwalla, R; Miller, C; Singhaus, R; Quinet, E; Savio, D; Halpern, A; Basso, M; Keith, J; Clerin, V; Chen, L; Resmini, C; Liu, QY; Feingold, I; Huselton, C; Azam, F; Farnegardh, M; Enroth, C; Bonn, T; Goos-Nilsson, A; Wilhelmsson, A; Nambi, P; Wrobel, J Discovery of phenyl acetic acid substituted quinolines as novel liver X receptor agonists for the treatment of atherosclerosis. J Med Chem49:6151-4 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Oxysterols receptor LXR-alpha [197-447] |
|---|
| Name: | Oxysterols receptor LXR-alpha [197-447] |
|---|
| Synonyms: | LXRA | Liver X Receptor alpha (LXR-alpha) | NR1H3 | NR1H3_HUMAN | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 28986.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
|---|
| Residue: | 251 |
|---|
| Sequence: | SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
|
|
|
|---|
| BDBM19992 |
|---|
| BDBM19993 |
|---|
| Name | BDBM19992 |
|---|
| Synonyms: | 2-[3-[3-[[2-chloro-3-(trifluoromethyl)phenyl]methyl-[2,2-di(phenyl)ethyl]amino]propoxy]phenyl]acetic acid | 2-{3-[3-({[2-chloro-3-(trifluoromethyl)phenyl]methyl}(2,2-diphenylethyl)amino)propoxy]phenyl}acetic acid | CHEMBL59030 | GSK-3965 | GW3965 | US10543183, Compound GW3965 | US10669296, Compound GW3965 | US10945978, Compound 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H31ClF3NO3 |
|---|
| Mol. Mass. | 582.052 |
|---|
| SMILES | OC(=O)Cc1cccc(OCCCN(CC(c2ccccc2)c2ccccc2)Cc2cccc(c2Cl)C(F)(F)F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
