Reaction Details |
| Report a problem with these data |
Target | Oxysterols receptor LXR-beta [154-461] |
---|
Ligand | BDBM19993 |
---|
Substrate/Competitor | BDBM19993 |
---|
Meas. Tech. | LXR Binding Assay and hLXR beta Reporter Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 277.15±n/a K |
---|
IC50 | 10±n/a nM |
---|
EC50 | 16±n/a nM |
---|
Comments | Efficacy=100% in transfected hLXRbeta reporter cell line assay. |
---|
Citation | Hu, B; Collini, M; Unwalla, R; Miller, C; Singhaus, R; Quinet, E; Savio, D; Halpern, A; Basso, M; Keith, J; Clerin, V; Chen, L; Resmini, C; Liu, QY; Feingold, I; Huselton, C; Azam, F; Farnegardh, M; Enroth, C; Bonn, T; Goos-Nilsson, A; Wilhelmsson, A; Nambi, P; Wrobel, J Discovery of phenyl acetic acid substituted quinolines as novel liver X receptor agonists for the treatment of atherosclerosis. J Med Chem49:6151-4 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Oxysterols receptor LXR-beta [154-461] |
---|
Name: | Oxysterols receptor LXR-beta [154-461] |
Synonyms: | LXRB | Liver X Receptor beta (LXR-beta) | NER | NR1H2 | NR1H2_HUMAN | Nuclear orphan receptor LXR-beta | Nuclear receptor NER | Nuclear receptor subfamily 1 group H member 2 | Oxysterols receptor LXR-beta | UNR | Ubiquitously-expressed nuclear receptor |
Type: | Receptor |
Mol. Mass.: | 34695.52 |
Organism: | Homo sapiens (Human) |
Description: | LXR beta ligand binding domain (amino acid residues 154-461) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
Residue: | 308 |
Sequence: | MREQCVLSEEQIRKKKIRKQQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGS
GEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFT
ELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKD
FTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRV
EALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPL
LSEIWDVH
|
|
|
BDBM19993 |
---|
BDBM19993 |
---|
Name | BDBM19993 |
Synonyms: | CHEMBL62136 | N-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)phenyl]-N-(2,2,2-trifluoroethyl)benzenesulfonamide | T 0901317 | T0901317 | TO-901317 | US10543183, Compound TO901317 | US10669296, Compound TO901317 | US10945978, Compound 1 | [3H]T0901317 |
Type | Small organic molecule |
Emp. Form. | C17H12F9NO3S |
Mol. Mass. | 481.333 |
SMILES | OC(c1ccc(cc1)N(CC(F)(F)F)S(=O)(=O)c1ccccc1)(C(F)(F)F)C(F)(F)F |
Structure |
|