| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate synthase |
|---|
| Ligand | BDBM20679 |
|---|
| Substrate/Competitor | BDBM18754 |
|---|
| Meas. Tech. | Thymidylate Synthase (TS) Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 31000±n/a nM |
|---|
| Citation |  Gangjee, A; Li, W; Yang, J; Kisliuk, RL Design, synthesis, and biological evaluation of classical and nonclassical 2-amino-4-oxo-5-substituted-6-methylpyrrolo[3,2-d]pyrimidines as dual thymidylate synthase and dihydrofolate reductase inhibitors. J Med Chem51:68-76 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Thymidylate synthase |
|---|
| Name: | Thymidylate synthase |
|---|
| Synonyms: | TS | TSase | TYSY_ECOLI | Thymidylate Synthase (TS) | thyA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30475.81 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 264 |
|---|
| Sequence: | MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
|
|
|
|---|
| BDBM20679 |
|---|
| BDBM18754 |
|---|
| Name | BDBM20679 |
|---|
| Synonyms: | 2-amino-5-[(4-fluorophenyl)methyl]-6-methyl-3H,4H,5H-pyrrolo[3,2-d]pyrimidin-4-one | Pyrrolo[3,2-d]pyrimidine analogue, 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H13FN4O |
|---|
| Mol. Mass. | 272.2776 |
|---|
| SMILES | Cc1cc2nc(N)[nH]c(=O)c2n1Cc1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
