BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP/microtubule affinity-regulating kinase 2
LigandBDBM247047
Substrate/Competitorn/a
Meas. Tech.PAR-1 FLIPR Assay
IC50 4.41±n/a nM
Citation Yang ZZhang FDong GKnowles SLMaletic M Preparation and use of 7a-amide substituted- 6,6-difluoro bicyclic himbacine derivatives as PAR-1 receptor antagonists US Patent  US9701669 Publication Date 7/11/2017  Article
More Info.:Get all data from this article,  Assay Method
 
MAP/microtubule affinity-regulating kinase 2
Name:MAP/microtubule affinity-regulating kinase 2
Synonyms:ELKL motif kinase 1 | EMK1 | MARK2 | PAR1 homolog | Par-1 | Serine/threonine-protein kinase MARK2
Type:PROTEIN
Mol. Mass.:87953.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774586
Residue:788
Sequence:
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTS
NSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTST
NRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHP
NKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAG
QLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPE
SKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDA
NSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIAS
KIANELKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM247047
n/a
NameBDBM247047
Synonyms:(S and R)-2- ((1R,3aR,6S, 7R,7aS)-7- ((E)-2-(5-(2- cyanophenyl) pyridin-2- yl)vinyl)- 5,5-difluoro- 1,6-dimethyl-3- oxooctahydro- isobenzofuran- 3a-yl)-2- hydroxyacetamide | US9701669, 20
TypeSmall organic molecule
Emp. Form.C26H25F2N3O4
Mol. Mass.481.4912
SMILESC[C@H]1OC(=O)[C@@]2(CC(F)(F)[C@@H](C)[C@H](\C=C\c3ccc(cn3)-c3ccccc3C#N)[C@H]12)C(O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: