Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 6 (5-HT6)
LigandBDBM21358
Substrate/CompetitorBDBM21342
Meas. Tech.Radioligand Labeled Binding Assay and cAMP Production
pH7.4±n/a
Temperature295.15±n/a K
Ki 2±0 nM
EC50 6.5±0.5 nM
CommentsAgonism of cAMP production.
Citation Cole DCStock JRLennox WJBernotas RCEllingboe JWBoikess SCoupet JSmith DLLeung LZhang GMFeng XKelly MFGalante RHuang PDawson LAMarquis KRosenzweig-Lipson SBeyer CESchechter LE Discovery of N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine as a potent, selective, and orally active 5-HT(6) receptor agonist. J Med Chem 50:5535-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
5-Hydroxytryptamine receptor 6 (5-HT6)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | 5-hydroxytryptamine receptor 6 (5-HT-6) | 5-hydroxytryptamine receptor 6 (5-HT6R) | 5-hydroxytryptamine receptor 6 (5HT6) | Serotonin (5-HT3) receptor | Serotonin 6 (5-HT6) receptor | Serotonin Receptor 6
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46968.43
Organism:Homo sapiens (Human)
Description:Cultured Hela cells expressing h5-HT6 receptors.
Residue:440
Sequence:
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21358
BDBM21342
NameBDBM21358
Synonyms:2-[1-({6-chloroimidazo[2,1-b][1,3]thiazole-5-}sulfonyl)-1H-indol-3-yl]ethan-1-amine | N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine | SAX-187 | WAY-181187
TypeSmall organic molecule
Emp. Form.C15H13ClN4O2S2
Mol. Mass.380.872
SMILESNCCc1cn(c2ccccc12)S(=O)(=O)c1c(Cl)nc2sccn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: