Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM21441
Substrate/CompetitorFluorescein-labeled BAX peptide
Meas. Tech.Fluorescence Polarization Assay and FL5.12 Cellular Assay
Ki<1±n/a nM
EC50 16±n/a nM
Citation Bruncko MOost TKBelli BADing HJoseph MKKunzer AMartineau DMcClellan WJMitten MNg SCNimmer PMOltersdorf TPark CMPetros AMShoemaker ARSong XWang XWendt MDZhang HFesik SWRosenberg SHElmore SW Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. J Med Chem 50:641-62 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21441
Fluorescein-labeled BAX peptide
Name:Fluorescein-labeled BAX peptide
Synonyms:n/a
Type:fluorescein-labeled probe
Mol. Mass.:2800.15
Organism:n/a
Description:n/a
Residue:25
Sequence:
FITC-QDASTKKLSECLKRIGDELDS