Reaction Details |
| Report a problem with these data |
Target | Galectin-7 |
---|
Ligand | BDBM21525 |
---|
Substrate/Competitor | BDBM21520 |
---|
Meas. Tech. | Fluorescence Polarization Assay |
---|
Kd | 130000±n/a nM |
---|
Citation | Salameh, BA; Sundin, A; Leffler, H; Nilsson, UJ Thioureido N-acetyllactosamine derivatives as potent galectin-7 and 9N inhibitors. Bioorg Med Chem14:1215-20 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Galectin-7 |
---|
Name: | Galectin-7 |
Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
Type: | Galactoside-binding protein |
Mol. Mass.: | 15077.89 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 136 |
Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
BDBM21525 |
---|
BDBM21520 |
---|
Name | BDBM21525 |
Synonyms: | N-[(2R,3R,4R,5S,6R)-5-{[(2S,3R,4S,5R,6R)-3,5-dihydroxy-4-{[(2-hydroxyethyl)carbamothioyl]amino}-6-(hydroxymethyl)oxan-2-yl]oxy}-4-hydroxy-6-(hydroxymethyl)-2-methoxyoxan-3-yl]acetamide | Thioureido N-acetyllactosamine derivative, 9 |
Type | n/a |
Emp. Form. | C18H33N3O11S |
Mol. Mass. | 499.533 |
SMILES | CO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H](CO)[C@H](O)[C@H](NC(=S)NCCO)[C@H]2O)[C@H](O)[C@H]1NC(C)=O |
Structure |
|