| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-7 |
|---|
| Ligand | BDBM21529 |
|---|
| Substrate/Competitor | BDBM21520 |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| Kd | 23000±n/a nM |
|---|
| Citation |  Salameh, BA; Sundin, A; Leffler, H; Nilsson, UJ Thioureido N-acetyllactosamine derivatives as potent galectin-7 and 9N inhibitors. Bioorg Med Chem14:1215-20 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Galectin-7 |
|---|
| Name: | Galectin-7 |
|---|
| Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
|---|
| Type: | Galactoside-binding protein |
|---|
| Mol. Mass.: | 15077.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 136 |
|---|
| Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
|---|
| BDBM21529 |
|---|
| BDBM21520 |
|---|
| Name | BDBM21529 |
|---|
| Synonyms: | N-[(2R,3R,4R,5S,6R)-5-{[(2S,3R,4S,5R,6R)-3,5-dihydroxy-6-(hydroxymethyl)-4-{[(pyridin-3-ylmethyl)carbamothioyl]amino}oxan-2-yl]oxy}-4-hydroxy-6-(hydroxymethyl)-2-methoxyoxan-3-yl]acetamide | Thioureido N-acetyllactosamine derivative, 13 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C22H34N4O10S |
|---|
| Mol. Mass. | 546.591 |
|---|
| SMILES | CO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H](CO)[C@H](O)[C@H](NC(=S)NCc3cccnc3)[C@H]2O)[C@H](O)[C@H]1NC(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
