| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM21593 |
|---|
| Substrate/Competitor | BDBM21544 |
|---|
| Meas. Tech. | Radioligand Binding Assay |
|---|
| Ki | 51±n/a nM |
|---|
| EC50 | 220±n/a nM |
|---|
| Citation |  Crosignani, S; Page, P; Missotten, M; Colovray, V; Cleva, C; Arrighi, JF; Atherall, J; Macritchie, J; Martin, T; Humbert, Y; Gaudet, M; Pupowicz, D; Maio, M; Pittet, PA; Golzio, L; Giachetti, C; Rocha, C; Bernardinelli, G; Filinchuk, Y; Scheer, A; Schwarz, MK; Chollet, A Discovery of a New Class of Potent, Selective, and Orally Bioavailable CRTH2 (DP2) Receptor Antagonists for the Treatment of Allergic Inflammatory Diseases. J Med Chem51:2227-2243 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM21593 |
|---|
| BDBM21544 |
|---|
| Name | BDBM21593 |
|---|
| Synonyms: | 2-{5-chloro-1'-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]-1,2-dihydrospiro[indole-3,3'-pyrrolidine]-2,2',5'-trione}acetic acid | Spiro-indolinone analogue, 85 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16ClN3O6 |
|---|
| Mol. Mass. | 417.8 |
|---|
| SMILES | Cc1noc(C)c1CN1C(=O)CC2(C1=O)C(=O)N(CC(O)=O)c1ccc(Cl)cc21 |
|---|
| Structure | 
|
|---|
Search and Browse
