| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM21603 |
|---|
| Substrate/Competitor | BDBM21544 |
|---|
| Meas. Tech. | Radioligand Binding Assay and [35S] GTP-gamma-S Binding Assay |
|---|
| Ki | 22±n/a nM |
|---|
| Citation |  Crosignani, S; Page, P; Missotten, M; Colovray, V; Cleva, C; Arrighi, JF; Atherall, J; Macritchie, J; Martin, T; Humbert, Y; Gaudet, M; Pupowicz, D; Maio, M; Pittet, PA; Golzio, L; Giachetti, C; Rocha, C; Bernardinelli, G; Filinchuk, Y; Scheer, A; Schwarz, MK; Chollet, A Discovery of a New Class of Potent, Selective, and Orally Bioavailable CRTH2 (DP2) Receptor Antagonists for the Treatment of Allergic Inflammatory Diseases. J Med Chem51:2227-2243 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD294 antigen | Crth2 | G protein-coupled receptor 44 | Gpr44 | PD2R2_MOUSE | Ptgdr2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42975.89 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Human embryonic kidney (HEK) 293(EBNA) cells were transfected with mouse CRTH2. |
|---|
| Residue: | 382 |
|---|
| Sequence: | MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
|
|
|
|---|
| BDBM21603 |
|---|
| BDBM21544 |
|---|
| Name | BDBM21603 |
|---|
| Synonyms: | 2-[(3R)-5-chloro-1'-[(2-fluorophenyl)methyl]-1,2-dihydrospiro[indole-3,3'-pyrrolidine]-2,2',5'-trione]acetic acid | Spiro-indolinone analogue, (R)-58 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14ClFN2O5 |
|---|
| Mol. Mass. | 416.787 |
|---|
| SMILES | OC(=O)CN1C(=O)[C@@]2(CC(=O)N(Cc3ccccc3F)C2=O)c2cc(Cl)ccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
