Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM21605 |
---|
Substrate/Competitor | BDBM21544 |
---|
Meas. Tech. | Radioligand Binding Assay and [35S] GTP-gamma-S Binding Assay |
---|
Ki | 33±n/a nM |
---|
Citation | Crosignani, S; Page, P; Missotten, M; Colovray, V; Cleva, C; Arrighi, JF; Atherall, J; Macritchie, J; Martin, T; Humbert, Y; Gaudet, M; Pupowicz, D; Maio, M; Pittet, PA; Golzio, L; Giachetti, C; Rocha, C; Bernardinelli, G; Filinchuk, Y; Scheer, A; Schwarz, MK; Chollet, A Discovery of a New Class of Potent, Selective, and Orally Bioavailable CRTH2 (DP2) Receptor Antagonists for the Treatment of Allergic Inflammatory Diseases. J Med Chem51:2227-2243 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD294 antigen | Crth2 | G protein-coupled receptor 44 | Gpr44 | PD2R2_MOUSE | Ptgdr2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42975.89 |
Organism: | Mus musculus (mouse) |
Description: | Human embryonic kidney (HEK) 293(EBNA) cells were transfected with mouse CRTH2. |
Residue: | 382 |
Sequence: | MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
|
|
|
BDBM21605 |
---|
BDBM21544 |
---|
Name | BDBM21605 |
Synonyms: | 2-[(3R)-5-chloro-1'-[(3-chlorophenyl)methyl]-1,2-dihydrospiro[indole-3,3'-pyrrolidine]-2,2',5'-trione]acetic acid | Spiro-indolinone analogue, (R)-60 |
Type | Small organic molecule |
Emp. Form. | C20H14Cl2N2O5 |
Mol. Mass. | 433.242 |
SMILES | OC(=O)CN1C(=O)[C@@]2(CC(=O)N(Cc3cccc(Cl)c3)C2=O)c2cc(Cl)ccc12 |r| |
Structure |
|