| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM21621 |
|---|
| Substrate/Competitor | BDBM21614 |
|---|
| Meas. Tech. | In Vitro GST Activity Assay |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 26400±n/a nM |
|---|
| Citation |  Hohwy, M; Spadola, L; Lundquist, B; Hawtin, P; Dahmén, J; Groth-Clausen, I; Nilsson, E; Persdotter, S; von Wachenfeldt, K; Folmer, RH; Edman, K Novel prostaglandin d synthase inhibitors generated by fragment-based drug design. J Med Chem51:2178-86 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM21621 |
|---|
| BDBM21614 |
|---|
| Name | BDBM21621 |
|---|
| Synonyms: | 3-(3,5-dimethyl-1H-pyrrol-2-yl)-1H-pyrazole | Pyrazole, 9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H11N3 |
|---|
| Mol. Mass. | 161.2037 |
|---|
| SMILES | Cc1cc(C)c([nH]1)-c1cc[nH]n1 |
|---|
| Structure | 
|
|---|
Search and Browse
