| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nuclear receptor subfamily 1 group I member 2 |
|---|
| Ligand | BDBM21673 |
|---|
| Substrate/Competitor | BDBM21662 |
|---|
| Meas. Tech. | Competition Ligand Binding Assay and Transient Transfection Assay |
|---|
| pH | 8±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 20±n/a nM |
|---|
| EC50 | 10±n/a nM |
|---|
| Citation |  Xue, Y; Chao, E; Zuercher, WJ; Willson, TM; Collins, JL; Redinbo, MR Crystal structure of the PXR-T1317 complex provides a scaffold to examine the potential for receptor antagonism. Bioorg Med Chem15:2156-66 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Nuclear receptor subfamily 1 group I member 2 |
|---|
| Name: | Nuclear receptor subfamily 1 group I member 2 |
|---|
| Synonyms: | NR1I2 | NR1I2_HUMAN | Orphan nuclear receptor PAR1 | Orphan nuclear receptor PXR | PXR | Pregnane X receptor | SXR | Steroid and xenobiotic receptor | nuclear receptor subfamily 1 group I member 2 isoform 1 |
|---|
| Type: | Nuclear receptor |
|---|
| Mol. Mass.: | 49774.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O75469 |
|---|
| Residue: | 434 |
|---|
| Sequence: | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
|
|
|
|---|
| BDBM21673 |
|---|
| BDBM21662 |
|---|
| Name | BDBM21673 |
|---|
| Synonyms: | N-[4-(1,1,1,3,3,4,4,5,5,5-decafluoro-2-hydroxypentan-2-yl)phenyl]-N-(2,2,2-trifluoroethyl)benzenesulfonamide | T0901317 analogue, 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H12F13NO3S |
|---|
| Mol. Mass. | 581.348 |
|---|
| SMILES | OC(c1ccc(cc1)N(CC(F)(F)F)S(=O)(=O)c1ccccc1)(C(F)(F)F)C(F)(F)C(F)(F)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
