Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonocarboxylate Transporter 1
LigandBDBM22011
Substrate/CompetitorBDBM21986
Meas. Tech.Radioligand Filter Binding Assay
pH7.8±n/a
Temperature295.15±n/a K
Ki 0.68±n/a nM
Citation Guile SDBantick JRCheshire DRCooper MEDavis AMDonald DKEvans REyssade CFerguson DDHill SHutchinson RIngall AHKingston LPMartin IMartin BPMohammed RTMurray CPerry MWReynolds RHThorne PVWilkinson DJWithnall J Potent blockers of the monocarboxylate transporter MCT1: novel immunomodulatory compounds. Bioorg Med Chem Lett 16:2260-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Monocarboxylate Transporter 1
Name:Monocarboxylate transporter 1
Synonyms:MCT 1 | Solute carrier family 16 member 1
Type:PROTEIN
Mol. Mass.:53956.64
Organism:Homo sapiens (Human)
Description:ChEMBL_1451367
Residue:500
Sequence:
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22011
BDBM21986
NameBDBM22011
Synonyms:5-{[(1S,3R,4S)-3,4-dihydroxycyclopentyl]sulfanyl}-3-methyl-1-(2-methylpropyl)-6-{[2-(trifluoromethyl)phenyl]methyl}-1H,2H,3H,4H-thieno[2,3-d]pyrimidine-2,4-dione | Thieno[2,3-d]pyrimidine-2,4(1H,3H)-dione, 18
TypeSmall organic molecule
Emp. Form.C24H27F3N2O4S2
Mol. Mass.528.607
SMILESCC(C)Cn1c2sc(Cc3ccccc3C(F)(F)F)c(S[C@H]3C[C@H](O)[C@H](O)C3)c2c(=O)n(C)c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: