| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin B-like cysteine protease |
|---|
| Ligand | BDBM22073 |
|---|
| Substrate/Competitor | BDBM22047 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | >25000±n/a nM |
|---|
| Citation |  Mallari, JP; Shelat, AA; Obrien, T; Caffrey, CR; Kosinski, A; Connelly, M; Harbut, M; Greenbaum, D; McKerrow, JH; Guy, RK Development of potent purine-derived nitrile inhibitors of the trypanosomal protease TbcatB. J Med Chem51:545-52 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Cathepsin B-like cysteine protease |
|---|
| Name: | Cathepsin B-like cysteine protease |
|---|
| Synonyms: | CPC | Cathepsin B-Like Cysteine Protease (TbcatB) | Cysteine peptidase C | TbcatB |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37220.37 |
|---|
| Organism: | Trypanosoma brucei |
|---|
| Description: | Enzyme was expressed in yeast Pichia pastoris. |
|---|
| Residue: | 340 |
|---|
| Sequence: | MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
|
|
|
|---|
| BDBM22073 |
|---|
| BDBM22047 |
|---|
| Name | BDBM22073 |
|---|
| Synonyms: | 9-benzyl-6-[(2-phenylethyl)amino]-9H-purine-2-carbonitrile | Compound 3{13,17} |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18N6 |
|---|
| Mol. Mass. | 354.4078 |
|---|
| SMILES | N#Cc1nc(NCCc2ccccc2)c2ncn(Cc3ccccc3)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
