Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B-Like Cysteine Protease (TbcatB)
LigandBDBM22100
Substrate/CompetitorBDBM22047
Meas. Tech.Enzyme Inhibition Assay
Temperature298.15±n/a K
IC50 800±n/a nM
Commentsextracted
Citation Mallari JPShelat AAObrien TCaffrey CRKosinski AConnelly MHarbut MGreenbaum DMcKerrow JHGuy RK Development of potent purine-derived nitrile inhibitors of the trypanosomal protease TbcatB. J Med Chem 51:545-52 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin B-Like Cysteine Protease (TbcatB)
Name:Cathepsin B-Like Cysteine Protease (TbcatB)
Synonyms:CPC | Cysteine peptidase C | TbcatB
Type:Enzyme
Mol. Mass.:37220.37
Organism:Trypanosoma brucei
Description:Enzyme was expressed in yeast Pichia pastoris.
Residue:340
Sequence:
MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22100
BDBM22047
NameBDBM22100
Synonyms:6-{[(3,4-dichlorophenyl)methyl]amino}-9-[3-(methoxymethoxy)propyl]-9H-purine-2-carbonitrile | Compound 3{12,8}
TypeSmall organic molecule
Emp. Form.C18H18Cl2N6O2
Mol. Mass.421.281
SMILESCOCOCCCn1cnc2c(NCc3ccc(Cl)c(Cl)c3)nc(nc12)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: