Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine nucleoside phosphorylase
LigandBDBM22109
Substrate/CompetitorBDBM22104
Meas. Tech.PNP Inhibition Assay
pH7.7±n/a
Temperature295.15±n/a K
Ki 1.1±0.12 nM
Km40000±n/a nM
CommentsKi is the dissociation constant for the first step in the two-step binding characteristic of slow-onset tight-binding inhibition.
Citation Evans GBFurneaux RHGreatrex BMurkin ASSchramm VLTyler PC Azetidine based transition state analogue inhibitors of N-ribosyl hydrolases and phosphorylases. J Med Chem 51:948-56 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Purine nucleoside phosphorylase
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:Enzyme
Mol. Mass.:32119.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22109
BDBM22104
NameBDBM22109
Synonyms:7-{[(3R,4R)-3-hydroxy-4-(hydroxymethyl)pyrrolidin-1-yl]methyl}-1,5-dihydro-4H-pyrrolo[3,2-d]pyrimidin-4-one | 7-{[(3R,4R)-3-hydroxy-4-(hydroxymethyl)pyrrolidin-1-yl]methyl}-1H,4H,5H-pyrrolo[3,2-d]pyrimidin-4-one | CHEMBL1213653 | CHEMBL269864 | DADMe-ImmH,7
Typen/a
Emp. Form.C12H16N4O3
Mol. Mass.264.2804
SMILESOC[C@H]1CN(Cc2c[nH]c3c2nc[nH]c3=O)C[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: