Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM22106
Substrate/CompetitorBDBM22104
Meas. Tech.PNP Inhibition Assay
pH7.7±n/a
Temperature295.15±n/a K
Ki 1290±30 nM
Km5000±n/a nM
Citation Evans GBFurneaux RHGreatrex BMurkin ASSchramm VLTyler PC Azetidine based transition state analogue inhibitors of N-ribosyl hydrolases and phosphorylases. J Med Chem 51:948-56 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine Nucleoside Phosphorylase (PNP)
Synonyms:pfPNP
Type:Enzyme
Mol. Mass.:26857.85
Organism:Plasmodium falciparum
Description:n/a
Residue:245
Sequence:
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22106
BDBM22104
NameBDBM22106
Synonyms:7-{[(2R,4S)-2,4-bis(hydroxymethyl)azetidin-1-yl]methyl}-3H,4H,5H-pyrrolo[3,2-d]pyrimidin-4-one | Azetidine based compound, 40
TypeSmall organic molecule
Emp. Form.C12H16N4O3
Mol. Mass.264.2804
SMILESOC[C@H]1C[C@@H](CO)N1Cc1c[nH]c2c1nc[nH]c2=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: