Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethylthioadenosine Phosphorylase (MTAP)
LigandBDBM22112
Substrate/CompetitorBDBM22111
Meas. Tech.MTAP/MTAN Inhibition Assay
pH7±n/a
Temperature295.15±n/a K
Ki 2.0±0.1 nM
Km5000±n/a nM
Citation Evans GBFurneaux RHGreatrex BMurkin ASSchramm VLTyler PC Azetidine based transition state analogue inhibitors of N-ribosyl hydrolases and phosphorylases. J Med Chem 51:948-56 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methylthioadenosine Phosphorylase (MTAP)
Name:Methylthioadenosine Phosphorylase (MTAP)
Synonyms:5'-Methylthioadenosine phosphorylase (MTAP) | MTA phosphorylase | MTAPase | S-methyl-5 -thioadenosine phosphorylase
Type:Enzyme
Mol. Mass.:31239.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:283
Sequence:
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22112
BDBM22111
NameBDBM22112
Synonyms:7-({3-[(methylsulfanyl)methyl]azetidin-1-yl}methyl)-5H-pyrrolo[3,2-d]pyrimidin-4-amine | Azetidine based compound, 44
TypeSmall organic molecule
Emp. Form.C12H17N5S
Mol. Mass.263.362
SMILESCSCC1CN(Cc2c[nH]c3c(N)ncnc23)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: