Reaction Details |
| Report a problem with these data |
Target | S-methyl-5'-thioadenosine phosphorylase |
---|
Ligand | BDBM22113 |
---|
Substrate/Competitor | BDBM22111 |
---|
Meas. Tech. | MTAP/MTAN Inhibition Assay |
---|
pH | 7±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 1.7±0.2 nM |
---|
Km | 5000±n/a nM |
---|
Comments | Ki is the dissociation constant for the first step in the two-step binding characteristic of slow-onset tight-binding inhibition. |
---|
Citation | Evans, GB; Furneaux, RH; Greatrex, B; Murkin, AS; Schramm, VL; Tyler, PC Azetidine based transition state analogue inhibitors of N-ribosyl hydrolases and phosphorylases. J Med Chem51:948-56 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
S-methyl-5'-thioadenosine phosphorylase |
---|
Name: | S-methyl-5'-thioadenosine phosphorylase |
Synonyms: | 5'-Methylthioadenosine phosphorylase (MTAP) | MSAP | MTA phosphorylase | MTAP | MTAP_HUMAN | MTAPase | Methylthioadenosine Phosphorylase (MTAP) | S-methyl-5 -thioadenosine phosphorylase |
Type: | Enzyme |
Mol. Mass.: | 31239.23 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 283 |
Sequence: | MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
|
|
|
BDBM22113 |
---|
BDBM22111 |
---|
Name | BDBM22113 |
Synonyms: | (3R,4S)-1-({4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl}methyl)-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol | (3R,4S)-1-[(9-Deazaadenin-9-yl)methyl]-3-hydroxy-4-methylthiomethylpyrrolidine, 7 | DADMe-ImmA-Me | MT-DADMe-ImmA |
Type | n/a |
Emp. Form. | C13H19N5OS |
Mol. Mass. | 293.388 |
SMILES | CSC[C@H]1CN(Cc2c[nH]c3c(N)ncnc23)C[C@@H]1O |r| |
Structure |
|