Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 1
LigandBDBM22450
Substrate/CompetitorBDBM22448
Meas. Tech.Enzyme Inhibition Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 88±n/a nM
Citation Estiu GGreenberg EHarrison CBKwiatkowski NPMazitschek RBradner JEWiest O Structural Origin of Selectivity in Class II-Selective Histone Deacetylase Inhibitors. J Med Chem 51:2898-906 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Histone deacetylase 1
Name:Histone deacetylase 1
Synonyms:HD1 | Histone deacetylase 1 (HDAC1) | Human HDAC1 | RPD3L1
Type:Enzyme
Mol. Mass.:55090.27
Organism:Homo sapiens (Human)
Description:Q13547
Residue:482
Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22450
BDBM22448
NameBDBM22450
Synonyms:N-hydroxy-N -(4-{(2R,4S,6R)-4-phenyl-6-[(pyridin-4-ylsulfanyl)methyl]-1,3-dioxan-2-yl}phenyl)octanediamide | N-hydroxy-N'-{4-[(2R,4S,6R)-4-phenyl-6-[(pyridin-4-ylsulfanyl)methyl]-1,3-dioxan-2-yl]phenyl}octanediamide | NK308
TypeSmall organic molecule
Emp. Form.C30H35N3O5S
Mol. Mass.549.681
SMILESONC(=O)CCCCCCC(=O)Nc1ccc(cc1)[C@H]1O[C@@H](CSc2ccncc2)C[C@H](O1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: