Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 6
LigandBDBM22450
Substrate/CompetitorBDBM22448
Meas. Tech.Enzyme Inhibition Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 28±n/a nM
Citation Estiu GGreenberg EHarrison CBKwiatkowski NPMazitschek RBradner JEWiest O Structural Origin of Selectivity in Class II-Selective Histone Deacetylase Inhibitors. J Med Chem 51:2898-906 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Histone deacetylase 6
Name:Histone deacetylase 1/6
Synonyms:HD6 | Histone deacetylase 6 (HDAC6) | Human HDAC6 | KIAA0901 | ORF Names:JM21
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:131381.51
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC6 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:1215
Sequence:
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22450
BDBM22448
NameBDBM22450
Synonyms:N-hydroxy-N -(4-{(2R,4S,6R)-4-phenyl-6-[(pyridin-4-ylsulfanyl)methyl]-1,3-dioxan-2-yl}phenyl)octanediamide | N-hydroxy-N'-{4-[(2R,4S,6R)-4-phenyl-6-[(pyridin-4-ylsulfanyl)methyl]-1,3-dioxan-2-yl]phenyl}octanediamide | NK308
TypeSmall organic molecule
Emp. Form.C30H35N3O5S
Mol. Mass.549.681
SMILESONC(=O)CCCCCCC(=O)Nc1ccc(cc1)[C@H]1O[C@@H](CSc2ccncc2)C[C@H](O1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: