Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM22543 |
---|
Substrate/Competitor | BDBM7966 |
---|
Meas. Tech. | H4R Radioligand Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Comments | 17 +/- 1 % inhibition of [3H]-histamine binding uM of test compound. |
---|
Citation | Wijtmans, M; Celanire, S; Snip, E; Gillard, MR; Gelens, E; Collart, PP; Venhuis, BJ; Christophe, B; Hulscher, S; van der Goot, H; Lebon, F; Timmerman, H; Bakker, RA; Lallemand, BI; Leurs, R; Talaga, PE; de Esch, IJ 4-benzyl-1H-imidazoles with oxazoline termini as histamine H3 receptor agonists. J Med Chem51:2944-53 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM22543 |
---|
BDBM7966 |
---|
Name | BDBM22543 |
Synonyms: | 2-[4-(1H-imidazol-4-ylmethyl)phenyl]-4,4-dimethyl-4,5-dihydro-1,3-oxazole | 4-Benzyl-1H-imidazole derivative, 11 |
Type | Small organic molecule |
Emp. Form. | C15H17N3O |
Mol. Mass. | 255.315 |
SMILES | CC1(C)COC(=N1)c1ccc(Cc2cnc[nH]2)cc1 |c:5| |
Structure |
|