| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM22558 |
|---|
| Substrate/Competitor | BDBM7966 |
|---|
| Meas. Tech. | Radioligand Binding Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 28±n/a nM |
|---|
| Citation |  Lee-Dutra, A; Arienti, KL; Buzard, DJ; Hack, MD; Khatuya, H; Desai, PJ; Nguyen, S; Thurmond, RL; Karlsson, L; Edwards, JP; Breitenbucher, JG Identification of 2-arylbenzimidazoles as potent human histamine H4 receptor ligands. Bioorg Med Chem Lett16:6043-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM22558 |
|---|
| BDBM7966 |
|---|
| Name | BDBM22558 |
|---|
| Synonyms: | 2-arylbenzimidazole derivative, 4 | 4-{2-chloro-4-[3-(4-methylpiperazin-1-yl)propoxy]phenyl}-3,5-diazatricyclo[7.4.0.0^{2,6}]trideca-1(9),2(6),3,7,10,12-hexaene |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27ClN4O |
|---|
| Mol. Mass. | 434.961 |
|---|
| SMILES | CN1CCN(CCCOc2ccc(-c3nc4c(ccc5ccccc45)[nH]3)c(Cl)c2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
