Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor XIIa
LigandBDBM22745
Substrate/CompetitorBDBM22723
Meas. Tech.Enzyme Inhibition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 8.9±0.9 nM
Citation Wadkins RMHyatt JLWei XYoon KJWierdl MEdwards CCMorton CLObenauer JCDamodaran KBeroza PDanks MKPotter PM Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem 48:2906-15 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Factor XIIa
Name:Coagulation factor XII
Synonyms:Beta-factor XIIa part 1 | Beta-factor XIIa part 2 | Carboxylesterase 2 (intestine, liver) | Coagulation factor XII | Coagulation factor XIIa heavy chain | Coagulation factor XIIa light chain | Factor XIIa (fXIIa) | HAF | Hageman factor
Type:Enzyme
Mol. Mass.:67810.07
Organism:Homo sapiens (Human)
Description:P00748
Residue:615
Sequence:
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22745
BDBM22723
NameBDBM22745
Synonyms:1-(2-chlorophenyl)-2-(3,4-dimethoxyphenyl)ethane-1,2-dione | Benzil-based compound, 23
TypeSmall organic molecule
Emp. Form.C16H13ClO4
Mol. Mass.304.725
SMILESCOc1ccc(cc1OC)C(=O)C(=O)c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: