new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3',5'-cyclic phosphodiesterase
LigandBDBM194474
Substrate/Competitorn/a
Meas. Tech.Homogenous Time-Resolved Fluorescence Resonance Energy Transfer (TR-FRET) Technology
IC50 0.710±n/a nM
Citation Leblond BTaverne TChauvignac CBeausoleil ECasagrande ADesire LPando MPDonello JEYang R Substituted 6, 7-dialkoxy-3-isoquinoline derivatives as inhibitors of phosphodiesterase 10 (PDE 10A) US Patent  US9902710 Publication Date 2/27/2018  Article
More Info.:Get all data from this article,  Assay Method
 
3',5'-cyclic phosphodiesterase
Name:cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
Synonyms:PDE10A | Phosphodiesterase 10 (PDE10) | Phosphodiesterase 10A
Type:Protein
Mol. Mass.:88412.52
Organism:Homo sapiens (Human)
Description:Q9Y233
Residue:779
Sequence:
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM194474
n/a
NameBDBM194474
Synonyms:US9200016, 156 | US9902710, Compound 156
TypeSmall organic molecule
Emp. Form.C22H22N4O4S
Mol. Mass.438.499
SMILESCOc1cc2c(C)ncc(Cc3ccc4cccc(NS(N)(=O)=O)c4n3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: