Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBacteriophage T4 DNA Ligase
LigandBDBM22984
Substrate/Competitor32P-labeled nicked duplex DNA substrate
Meas. Tech.In Vitro Ligase Activity Assay
pH7.6±n/a
Temperature298.15±n/a K
IC50 3000±200 nM
Citation Srivastava SKTripathi RPRamachandran R NAD+-dependent DNA Ligase (Rv3014c) from Mycobacterium tuberculosis. Crystal structure of the adenylation domain and identification of novel inhibitors. J Biol Chem 280:30273-81 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Bacteriophage T4 DNA Ligase
Name:Bacteriophage T4 DNA Ligase
Synonyms:ATP-dependent DNA ligase | Polydeoxyribonucleotide synthase [ATP]
Type:Enzyme
Mol. Mass.:55291.48
Organism:Bacteriophage T4
Description:n/a
Residue:487
Sequence:
MILKILNEIASIGSTKQKQAILEKNKDNELLKRVYRLTYSRGLQYYIKKWPKPGIATQSF
GMLTLTDMLDFIEFTLATRKLTGNAAIEELTGYITDGKKDDVEVLRRVMMRDLECGASVS
IANKVWPGLIPEQPQMLASSYDEKGINKNIKFPAFAQLKADGARCFAEVRGDELDDVRLL
SRAGNEYLGLDLLKEELIKMTAEARQIHPEGVLIDGELVYHEQVKKEPEGLDFLFDAYPE
NSKAKEFAEVAESRTASNGIANKSLKGTISEKEAQCMKFQVWDYVPLVEIYSLPAFRLKY
DVRFSKLEQMTSGYDKVILIENQVVNNLDEAKVIYKKYIDQGLEGIILKNIDGLWENARS
KNLYKFKEVIDVDLKIVGIYPHRKDPTKAGGFILESECGKIKVNAGSGLKDKAGVKSHEL
DRTRIMENQNYYIGKILECECNGWLKSDGRTDYVKLFLPIAIRLREDKTKANTFEDVFGD
FHEVTGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22984
32P-labeled nicked duplex DNA substrate
Name:32P-labeled nicked duplex DNA substrate
Synonyms:n/a
Type:Duplex DNA
Mol. Mass.:3295.68
Organism:n/a
Description:n/a
Residue:40
Sequence:
5-ATG TCC AGT GAT CCA GCT AAG GTA CGA GTC TAT GTC CAG G-3