Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM23165 |
---|
Substrate/Competitor | BDBM22202 |
---|
Meas. Tech. | [32P] S1P Binding Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 277.15±n/a K |
---|
Ki | >1000±n/a nM |
---|
Citation | Kiuchi, M; Adachi, K; Tomatsu, A; Chino, M; Takeda, S; Tanaka, Y; Maeda, Y; Sato, N; Mitsutomi, N; Sugahara, K; Chiba, K Asymmetric synthesis and biological evaluation of the enantiomeric isomers of the immunosuppressive FTY720-phosphate. Bioorg Med Chem13:425-32 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM23165 |
---|
BDBM22202 |
---|
Name | BDBM23165 |
Synonyms: | CHEMBL366208 | FTY720-phosphate, (S)-2 | [(2S)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid |
Type | Small organic molecule |
Emp. Form. | C19H34NO5P |
Mol. Mass. | 387.4507 |
SMILES | CCCCCCCCc1ccc(CC[C@](N)(CO)COP(O)(O)=O)cc1 |r| |
Structure |
|