| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM23164 |
|---|
| Substrate/Competitor | BDBM22202 |
|---|
| Meas. Tech. | [32P] S1P Binding Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| Ki | 586±66.5 nM |
|---|
| Citation |  Kiuchi, M; Adachi, K; Tomatsu, A; Chino, M; Takeda, S; Tanaka, Y; Maeda, Y; Sato, N; Mitsutomi, N; Sugahara, K; Chiba, K Asymmetric synthesis and biological evaluation of the enantiomeric isomers of the immunosuppressive FTY720-phosphate. Bioorg Med Chem13:425-32 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM23164 |
|---|
| BDBM22202 |
|---|
| Name | BDBM23164 |
|---|
| Synonyms: | CHEMBL190006 | FTY720-phosphate, (R)-2 | [(2R)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34NO5P |
|---|
| Mol. Mass. | 387.4507 |
|---|
| SMILES | CCCCCCCCc1ccc(CC[C@@](N)(CO)COP(O)(O)=O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
