| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM23324 |
|---|
| Substrate/Competitor | BDBM23318 |
|---|
| Meas. Tech. | Peptidyl Prolyl Isomerase (PPIase) Inibition Assay |
|---|
| pH | 8±n/a |
|---|
| Temperature | 273.15±n/a K |
|---|
| Ki | 240±n/a nM |
|---|
| Km | 520000±80000 nM |
|---|
| kcat | 344±26 1/sec |
|---|
| Citation |  Wu, YQ; Wilkinson, DE; Limburg, D; Li, JH; Sauer, H; Ross, D; Liang, S; Spicer, D; Valentine, H; Fuller, M; Guo, H; Howorth, P; Soni, R; Chen, Y; Steiner, JP; Hamilton, GS Synthesis of ketone analogues of prolyl and pipecolyl ester FKBP12 ligands. J Med Chem45:3558-68 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FKBP | FK506-binding protein 1A | FKB1A_BOVIN | FKBP-12 | FKBP1 | FKBP1A | Immunophilin FKBP12 | PPIase | Rotamase |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11911.51 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled. |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
|
|
|
|---|
| BDBM23324 |
|---|
| BDBM23318 |
|---|
| Name | BDBM23324 |
|---|
| Synonyms: | 1-[(2S)-2-[5-(4-hydroxyphenyl)pentanoyl]pyrrolidin-1-yl]-3,3-dimethylpentane-1,2-dione | N-Glyoxylprolyl ketone, 5g |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31NO4 |
|---|
| Mol. Mass. | 373.4858 |
|---|
| SMILES | CCC(C)(C)C(=O)C(=O)N1CCC[C@H]1C(=O)CCCCc1ccc(O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
