Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetImmunophilin FKBP12
LigandBDBM23334
Substrate/CompetitorBDBM23318
Meas. Tech.Peptidyl Prolyl Isomerase (PPIase) Inibition Assay
pH8±n/a
Temperature273.15±n/a K
Ki 7.5±n/a nM
Km520000±80000 nM
kcat344±26 1/sec
Citation Wu YQWilkinson DELimburg DLi JHSauer HRoss DLiang SSpicer DValentine HFuller MGuo HHoworth PSoni RChen YSteiner JPHamilton GS Synthesis of ketone analogues of prolyl and pipecolyl ester FKBP12 ligands. J Med Chem 45:3558-68 (2002) [PubMed]
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Immunophilin FKBP12
Name:Immunophilin FKBP12
Synonyms:12 kDa FKBP | FK506-binding protein 1A | FKBP-12 | PPIase | Rotamase
Type:Isomerase
Mol. Mass.:11911.51
Organism:Bos taurus (bovine)
Description:The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled.
Residue:108
Sequence:
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23334
BDBM23318
NameBDBM23334
Synonyms:3-(pyridin-3-yl)propyl (2S)-1-(3,3-dimethyl-2-oxopentanoyl)pyrrolidine-2-carboxylate | CHEMBL6367 | GPI 1046
TypeSmall organic molecule
Emp. Form.C20H28N2O4
Mol. Mass.360.4473
SMILESCCC(C)(C)C(=O)C(=O)N1CCC[C@H]1C(=O)OCCCc1cccnc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: