Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetImmunophilin FKBP12
LigandBDBM23393
Substrate/CompetitorBDBM23318
Meas. Tech.Peptidyl Prolyl Isomerase (PPIase) Inibition Assay
Ki 360±n/a nM
Citation Hudack RABarta NSGuo CDeal JDong LFay LKCaprathe BChatterjee AVanderpool DBigge CShowalter RBender SAugelli-Szafran CELunney EHou X Design, synthesis, and biological activity of novel polycyclic aza-amide FKBP12 ligands. J Med Chem 49:1202-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Immunophilin FKBP12
Name:Immunophilin FKBP12
Synonyms:12 kDa FKBP | FK506-binding protein 1A | FKBP-12 | PPIase | Rotamase
Type:Isomerase
Mol. Mass.:11911.51
Organism:Bos taurus (bovine)
Description:The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled.
Residue:108
Sequence:
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23393
BDBM23318
NameBDBM23393
Synonyms:6-methoxy-17-(piperidine-1-sulfonyl)-11,17-diazatetracyclo[11.3.1.0^{2,11}.0^{3,8}]heptadeca-3(8),4,6-trien-12-one | Tetracyclic aza-amide, 14g
TypeSmall organic molecule
Emp. Form.C21H29N3O4S
Mol. Mass.419.538
SMILESCOc1ccc2C3C4CCCC(N4S(=O)(=O)N4CCCCC4)C(=O)N3CCc2c1 |TLB:13:12:8.9.10:24.6.22|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: