| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM23394 |
|---|
| Substrate/Competitor | BDBM23318 |
|---|
| Meas. Tech. | Peptidyl Prolyl Isomerase (PPIase) Inibition Assay |
|---|
| Ki | 590±n/a nM |
|---|
| Citation |  Hudack, RA; Barta, NS; Guo, C; Deal, J; Dong, L; Fay, LK; Caprathe, B; Chatterjee, A; Vanderpool, D; Bigge, C; Showalter, R; Bender, S; Augelli-Szafran, CE; Lunney, E; Hou, X Design, synthesis, and biological activity of novel polycyclic aza-amide FKBP12 ligands. J Med Chem49:1202-6 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FKBP | FK506-binding protein 1A | FKB1A_BOVIN | FKBP-12 | FKBP1 | FKBP1A | Immunophilin FKBP12 | PPIase | Rotamase |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11911.51 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | The enzyme was purified from calf thymus. The collected protein was further applied to Sephacryl column, and the fraction contained high PPIase activity was pooled. |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
|
|
|
|---|
| BDBM23394 |
|---|
| BDBM23318 |
|---|
| Name | BDBM23394 |
|---|
| Synonyms: | 6-methoxy-12-oxo-N-(2,4,5-trifluorophenyl)-11,17-diazatetracyclo[11.3.1.0^{2,11}.0^{3,8}]heptadeca-3(8),4,6-triene-17-sulfonamide | Tetracyclic aza-amide, 14h |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22F3N3O4S |
|---|
| Mol. Mass. | 481.488 |
|---|
| SMILES | COc1ccc2C3C4CCCC(N4S(=O)(=O)Nc4cc(F)c(F)cc4F)C(=O)N3CCc2c1 |TLB:13:12:8.9.10:28.6.26| |
|---|
| Structure | 
|
|---|
Search and Browse
