Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Ketoacyl-ACP Synthase III (FabH)
LigandBDBM23585
Substrate/CompetitorBDBM3158
Meas. Tech.FabD/FabH Coupled Assay
pH7±n/a
Temperature295.15±n/a K
IC50 3±n/a nM
Citation Nie ZPerretta CLu JSu YMargosiak SGajiwala KSCortez JNikulin VYager KMAppelt KChu S Structure-based design, synthesis, and study of potent inhibitors of beta-ketoacyl-acyl carrier protein synthase III as potential antimicrobial agents. J Med Chem 48:1596-609 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
beta-Ketoacyl-ACP Synthase III (FabH)
Name:beta-Ketoacyl-ACP Synthase III (FabH)
Synonyms:3-oxoacyl-[acyl-carrier-protein] synthase 3 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Beta-ketoacyl-ACP synthase III | KAS III
Type:Acyltransferase; homodimer
Mol. Mass.:34846.68
Organism:Streptococcus pyogenes
Description:The S. pyogenes FabH was cloned, and protein was expressed in E. coli.
Residue:324
Sequence:
MIFSKISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVAD
QLLTQSGLKADAIDFIIVATISPDATMPSTAAKVQAAIAATSAFAFDMTAACSGFVFALA
MADKLIASGAYQNGMVIGAETLSKLVNWQDRATAVLFGDGAGGVLLEASKDKHVLAETLH
TDGARCQSLISGETSLSSPYSIGKKAIATIQMDGRAIFDFAIRDVSKSILTLMAQSDITK
DDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRYGNTSAASIPILLSEAVQKGQIRL
DGTQKILLSGFGGGLTWGSLIVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23585
BDBM3158
NameBDBM23585
Synonyms:(3-Phenoxybenzoylamino)benzoic acid deriv., 24i | 2-{[4-(4-methanesulfonylphenyl)-3-phenoxybenzene]amido}benzoic acid
TypeSmall organic molecule
Emp. Form.C27H21NO6S
Mol. Mass.487.524
SMILESCS(=O)(=O)c1ccc(cc1)-c1ccc(cc1Oc1ccccc1)C(=O)Nc1ccccc1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: