| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
|---|
| Ligand | BDBM23600 |
|---|
| Substrate/Competitor | BDBM3158 |
|---|
| Meas. Tech. | FabD/FabH Coupled Assay |
|---|
| IC50 | 790±n/a nM |
|---|
| Citation |  Nie, Z; Perretta, C; Lu, J; Su, Y; Margosiak, S; Gajiwala, KS; Cortez, J; Nikulin, V; Yager, KM; Appelt, K; Chu, S Structure-based design, synthesis, and study of potent inhibitors of beta-ketoacyl-acyl carrier protein synthase III as potential antimicrobial agents. J Med Chem48:1596-609 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
|---|
| Name: | 3-oxoacyl-[acyl-carrier-protein] synthase 3 |
|---|
| Synonyms: | 3-oxoacyl-[acyl-carrier-protein] synthase 3 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Beta-ketoacyl-ACP synthase III | FABH_ENTFA | KAS III | beta-Ketoacyl-ACP Synthase III (FabH) | fabH |
|---|
| Type: | Acyltransferase; homodimer |
|---|
| Mol. Mass.: | 35176.53 |
|---|
| Organism: | Enterococcus faecalis |
|---|
| Description: | The E. faecalis FabH was cloned, and protein was expressed in E. coli. |
|---|
| Residue: | 321 |
|---|
| Sequence: | MKNYARISCTSRYVPENCVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVA
KQLLEKSGKQASEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYAL
SMAEKLVLSGRYQTGLVIGGETFSKMLDWTDRSTAVLFGDGAAGVLIEAAETPHFLNEKL
QADGQRWAALTSGYTINESPFYQGHKQASKTLQMEGRSIFDFAIKDVSQNILSLVTDETV
DYLLLHQANVRIIDKIARKTKISREKFLTNMDKYGNTSAASIPILLDEAVENGTLILGSQ
QRVVLTGFGGGLTWGSLLLTL
|
|
|
|---|
| BDBM23600 |
|---|
| BDBM3158 |
|---|
| Name | BDBM23600 |
|---|
| Synonyms: | (3-Phenoxybenzoylamino)benzoic acid deriv., 24j | 2-({3-phenoxy-4-[3-(propan-2-yl)phenyl]benzene}amido)benzoic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H25NO4 |
|---|
| Mol. Mass. | 451.5131 |
|---|
| SMILES | CC(C)c1cccc(c1)-c1ccc(cc1Oc1ccccc1)C(=O)Nc1ccccc1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
