Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM23713
Substrate/CompetitorBDBM23699
Meas. Tech.Human Neutrophil Elastase Inhibition Assay
pH7.5±n/a
Temperature298.15±n/a K
Ki 230±n/a nM
Citation Schepetkin IAKhlebnikov AIQuinn MT N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. J Med Chem 50:4928-38 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23713
BDBM23699
NameBDBM23713
Synonyms:4-chloro-1-[(2-methylphenyl)carbonyl]-1H-pyrazole | N-Benzoylpyrazole deriv., 21
TypeSmall organic molecule
Emp. Form.C11H9ClN2O
Mol. Mass.220.655
SMILESCc1ccccc1C(=O)n1cc(Cl)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: