Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-1
LigandBDBM23866
Substrate/CompetitorBDBM23856
Meas. Tech.mu-Calpain Inhibition Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 10±0.3 nM
Citation Donkor IOAssefa HLiu J Structural basis for the potent calpain inhibitory activity of peptidyl alpha-ketoacids. J Med Chem 51:4346-50 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Calpain-1
Name:Calpain 1
Synonyms:CANP 1 | Calcium-activated neutral proteinase 1 | Calpain mu-type | Calpain-1 catalytic subunit | Calpain-1 large subunit | Micromolar-calpain | muCANP
Type:Catalytic subunit; forms a heterodimer with a small (regulatory) subunit (CAPNS1)
Mol. Mass.:81729.82
Organism:Sus scrofa (pig)
Description:Native calpain-1 from porcine erythrocytes, purchased from Calbiochem, was used in assay.
Residue:714
Sequence:
MAEEVITPVYCTGVSAQVQKLRAKELGLGRHENAIKYLGQDYEQLRAHCLQSGSLFRDEA
FPPVPQSLGFKELGPNSSKTYGVKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYSIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYQRDQLRVRMEDGEFWMSFRDFLREFTRLEICNLTPDALKS
QRVRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPEDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQVQAILPDEQVLSE
EEIDENFKALFRQLAGEDMEISVRELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLFELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23866
BDBM23856
NameBDBM23866
Synonyms:MDL28170 | Z-Val-Phe-CHO | benzyl N-[(1S)-2-methyl-1-[(1-oxo-3-phenylpropan-2-yl)carbamoyl]propyl]carbamate | calpain inhibitor III
TypeSmall organic molecule
Emp. Form.C22H26N2O4
Mol. Mass.382.4528
SMILESCC(C)C(NC(=O)OCc1ccccc1)C(=O)NC(Cc1ccccc1)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: