Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM24220
Substrate/CompetitorBDBM24200
Meas. Tech.Epoxide Hydrolase Assay
pH7.4±n/a
Temperature295.15±n/a K
IC50 16±5 nM
Citation Grice CATays KLSavall BMWei JButler CRAxe FUBembenek SDFourie AMDunford PJLundeen KColes FXue XRiley JPWilliams KNKarlsson LEdwards JP Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem 51:4150-69 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:LTA-4 hydrolase | Leukotriene A(4) hydrolase | Leukotriene A-4 hydrolase (LTA4H)
Type:Hydrolase; metalloprotease
Mol. Mass.:69280.41
Organism:Homo sapiens (Human)
Description:Human recombinant LTA4H.
Residue:611
Sequence:
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24220
BDBM24200
NameBDBM24220
Synonyms:1-(1-{2-[4-(1,3-benzothiazol-2-yloxy)phenoxy]ethyl}piperidin-4-yl)pyrrolidin-2-one | Benzthiazole compound, 11j
TypeSmall organic molecule
Emp. Form.C24H27N3O3S
Mol. Mass.437.554
SMILESO=C1CCCN1C1CCN(CCOc2ccc(Oc3nc4ccccc4s3)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: