new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitotic checkpoint serine/threonine-protein kinase BUB1
LigandBDBM378946
Substrate/Competitorn/a
Meas. Tech.Bub1 Kinase Assay
IC50 4.40±n/a nM
Citation Hitchcock MMengel APütter VSiemeister GWengner AMBriem HEis KSchulze VFernandez-Montalvan AEPrechtl SHolton SFanghänel JLienau PPreusse CGnoth MJ Substituted benzylindazoles for use as Bub1 kinase inhibitors in the treatment of hyperproliferative diseases US Patent  US10266548 Publication Date 4/23/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Mitotic checkpoint serine/threonine-protein kinase BUB1
Name:Mitotic checkpoint serine/threonine-protein kinase BUB1
Synonyms:BUB1A | hBUB1
Type:PROTEIN
Mol. Mass.:122372.31
Organism:Homo sapiens (Human)
Description:ChEMBL_1510603
Residue:1085
Sequence:
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKK
KYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASA
VLQRGIQNQAEPREFLQQQYRLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGN
NMACISKNQGSELSGVISSACDKESNMERRVITISKSEYSVHSSLASKVDVEQVVMYCKE
KLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKEANAFEEQLLKQKMDELHKKL
HQVVETSHEDLPASQERSEVNPARMGPSVGSQQELRAPCLPVTYQQTPVNMEKNPREAPP
VVPPLANAISAALVSPATSQSIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSG
AEIKEGCETHKVANTSSFHTTPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTL
PDISDDKDEWQSLDQNEDAFEAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGL
PQPKNKPTGARTFGERSVSRLPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDF
TSAAQLASTPFHKLPVESVHILEDKENVVAKQCTQATLDSCEENMVVPSRDGKFSPIQEK
SPKQALSSHMYSASLLRLSQPAAGGVLTCEAELGVEACRLTDTDAAIAEDPPDAIAGLQA
EWMQMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEF
QLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMER
LKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMR
MLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGT
IFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFR
RLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLEC
KRSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM378946
n/a
NameBDBM378946
Synonyms:2-[1-(2-chloro- 4,5- dimethylbenzyl)- 1H-indazol-3-yl]- 5-methoxy-N- (pyridin-4- yl)pyrimidin-4- amine | US10266548, Example 2-3-1
TypeSmall organic molecule
Emp. Form.C26H23ClN6O
Mol. Mass.470.953
SMILESCOc1cnc(nc1Nc1ccncc1)-c1nn(Cc2cc(C)c(C)cc2Cl)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: