Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM19130
Substrate/CompetitorCarboxyfluorescein (FAM)-labeled acetylated peptide
Meas. Tech.HDAC Inhibition Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 14±n/a nM
Citation Chen YLopez-Sanchez MSavoy DNBilladeau DDDow GSKozikowski AP A series of potent and selective, triazolylphenyl-based histone deacetylases inhibitors with activity against pancreatic cancer cells and Plasmodium falciparum. J Med Chem 51:3437-48 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:Q92769
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19130
Carboxyfluorescein (FAM)-labeled acetylated peptide
Name:Carboxyfluorescein (FAM)-labeled acetylated peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a