Reaction Details |
| Report a problem with these data |
Target | Fatty acid synthase [2202-2509] |
---|
Ligand | BDBM24984 |
---|
Substrate/Competitor | BDBM24568 |
---|
Meas. Tech. | Fluorogenic Assay for Detection of FASTE Inhibition |
---|
pH | 7.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 380±100 nM |
---|
Citation | Richardson, RD; Smith, JW Novel antagonists of the thioesterase domain of human fatty acid synthase. Mol Cancer Ther6:2120-6 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Fatty acid synthase [2202-2509] |
---|
Name: | Fatty acid synthase [2202-2509] |
Synonyms: | FAS | FASN | FAS_HUMAN | Fatty Acid Synthase |
Type: | Thioesterase domain |
Mol. Mass.: | 33927.11 |
Organism: | Homo sapiens (Human) |
Description: | The recombinant thioesterase domain (residues 2202-2509) of FAS was cloned and expressed in Escheria coli. The thioesterase was purified by Ni-affinity chromatography, and analyzed for activity and inhibition by Orlistat. |
Residue: | 308 |
Sequence: | CPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLA
SRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQL
QAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHN
RVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHG
NVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSL
AEPRVSVR
|
|
|
BDBM24984 |
---|
BDBM24568 |
---|
Name | BDBM24984 |
Synonyms: | (5E)-1-(3,5-dimethylphenyl)-5-[(5-phenylfuran-2-yl)methylidene]-1,3-diazinane-2,4,6-trione | 5-(furan-2-ylmethylene) pyrimidine-2,4,6-trione derivative, 1 |
Type | Small organic molecule |
Emp. Form. | C23H18N2O4 |
Mol. Mass. | 386.4 |
SMILES | Cc1cc(C)cc(c1)N1C(=O)NC(=O)C(=Cc2ccc(o2)-c2ccccc2)C1=O |w:15.16| |
Structure |
|