Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal S6 Kinase 1 (RSK-1)
LigandBDBM25017
Substrate/CompetitorRSK Substrate Peptide
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 31±5 nM
Citation Sapkota GPCummings LNewell FSArmstrong CBain JFrodin MGrauert MHoffmann MSchnapp GSteegmaier MCohen PAlessi DR BI-D1870 is a specific inhibitor of the p90 RSK (ribosomal S6 kinase) isoforms in vitro and in vivo. Biochem J 401:29-38 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ribosomal S6 Kinase 1 (RSK-1)
Name:Ribosomal S6 Kinase 1 (RSK-1)
Synonyms:90 kDa ribosomal protein S6 kinase 1 | MAP kinase-activated protein kinase 1a | MAPKAPK1A | Ribosomal protein S6 kinase alpha-1 | p90-RSK 1 | p90S6K | pp90RSK1
Type:Serine/threonine-protein kinase
Mol. Mass.:82866.82
Organism:Rattus norvegicus (rat)
Description:The rat RSK1 sequence contained His6-tag positioned N-terminal to the initiating methionine residue and differed from the Genbank entry M99169, at three residues E551G, S637N and G697A. The protein was cloned and purified from baculovirus expression system.
Residue:735
Sequence:
MPLAQLKEPWPLMELVPLDPENGQASGEEAGLQPSKDEGILKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDNGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHT
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHIFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
RDSPGIPPSAGAHQLFRGFSFVATGLMEDDSKPRATQAPLHSVVQQLHGKNLVFSDGYIV
KETIGVGSYSVCKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DSKHVYLVTELMRGGELLDKILRQKFFSEREASFVLYTISKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPGCLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GVLLYTMLAGYTPFANGPSDTPEEILTRISSGKFTLNGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQLVKGAMAATYSALSSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25017
RSK Substrate Peptide
Name:RSK Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:1132.38
Organism:n/a
Description:n/a
Residue:10
Sequence:
KKLNRTLSVA