Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 2
LigandBDBM25017
Substrate/CompetitorRSK Substrate Peptide
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 18±3 nM
Citation Sapkota GPCummings LNewell FSArmstrong CBain JFrodin MGrauert MHoffmann MSchnapp GSteegmaier MCohen PAlessi DR BI-D1870 is a specific inhibitor of the p90 RSK (ribosomal S6 kinase) isoforms in vitro and in vivo. Biochem J 401:29-38 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ribosomal protein S6 kinase alpha 2
Name:Ribosomal protein S6 kinase alpha 2
Synonyms:90 kDa ribosomal protein S6 kinase 2 | 90 kDa ribosomal protein S6 kinase 2 (RSK2) | MAP kinase-activated protein kinase 1c | MAPKAPK1C | RPS6KA2(Kin.Dom.1 - N-terminal) | Ribosomal S6 Kinase 3 (RSK-3) | Ribosomal protein S6 kinase alpha-2 | p90-RSK 2 | pp90RSK3
Type:Serine/threonine-protein kinase
Mol. Mass.:83259.46
Organism:Homo sapiens (Human)
Description:n/a
Residue:733
Sequence:
MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
QRRGMKRLTSTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25017
RSK Substrate Peptide
Name:RSK Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:1132.38
Organism:n/a
Description:n/a
Residue:10
Sequence:
KKLNRTLSVA