Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 6
LigandBDBM25017
Substrate/CompetitorRSK Substrate Peptide
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 15±7 nM
Citation Sapkota GPCummings LNewell FSArmstrong CBain JFrodin MGrauert MHoffmann MSchnapp GSteegmaier MCohen PAlessi DR BI-D1870 is a specific inhibitor of the p90 RSK (ribosomal S6 kinase) isoforms in vitro and in vivo. Biochem J 401:29-38 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ribosomal protein S6 kinase alpha 6
Name:Ribosomal protein S6 kinase alpha 6
Synonyms:90 kDa ribosomal protein S6 kinase 6 | RPS6KA6(Kin.Dom.1 - N-terminal) | RPS6KA6(Kin.Dom.2 - C-terminal) | RSK-4 | Ribosomal S6 Kinase 4 (RSK-4) | Ribosomal S6 kinase 4 | Ribosomal protein S6 kinase alpha 6 | Ribosomal protein S6 kinase alpha-6 | S6K-alpha 6 | p90-RSK 6 | pp90RSK4
Type:Serine/threonine-protein kinase
Mol. Mass.:83868.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:745
Sequence:
MLPFAPQDEPWDREMEVFSGGGASSGEVNGLKMVDEPMEEGEADSCHDEGVVKEIPITHH
VKEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRT
KMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLA
ELALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYM
APEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEA
QSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWDKLYKREVQPPFKPASGKPDDTFCF
DPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAA
QFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNI
ITLKDVFDDGRYVYLVTDLMKGGELLDRILKQKCFSEREASDILYVISKTVDYLHCQGVV
HRDLKPSNILYMDESASADSIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYD
AACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKDLL
SHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQ
PVLEPVAASSLAQRRSMKKRTSTGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25017
RSK Substrate Peptide
Name:RSK Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:1132.38
Organism:n/a
Description:n/a
Residue:10
Sequence:
KKLNRTLSVA