Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolo-Like Kinase 3
LigandBDBM25116
Substrate/CompetitorBiotinylated PLKtide
Meas. Tech.PLK Kinase Assay
Ki>20000±n/a nM
Citation Johnson EFStewart KDWoods KWGiranda VLLuo Y Pharmacological and functional comparison of the polo-like kinase family: insight into inhibitor and substrate specificity. Biochemistry 46:9551-63 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Polo-Like Kinase 3
Name:Serine/threonine-protein kinase PLK3
Synonyms:Cytokine-inducible serine/threonine-protein kinase | FGF-inducible kinase | Polo-Like Kinase 3 | Proliferation-related kinase | Serine/threonine-protein kinase PLK3
Type:Serine/threonine-protein kinase
Mol. Mass.:71655.17
Organism:Homo sapiens (Human)
Description:Enzyme assays were using PLK3 purified from baculovirus-infected Trichoplusia ni cells expressing full-length PLK3.
Residue:646
Sequence:
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25116
Biotinylated PLKtide
Name:Biotinylated PLKtide
Synonyms:n/a
Type:Peptide
Mol. Mass.:1447.52
Organism:n/a
Description:n/a
Residue:13
Sequence:
EVIEASFAEQEAK