Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM192
Substrate/Competitorfluorogenic peptide substrate
Meas. Tech.Protease Inhibition Assay
pH4.7±n/a
Temperature303.15±n/a K
Ki 0.07±n/a nM
Comments
Citation Sham HLZhao CStewart KDBetebenner DALin SPark CHKong XPRosenbrook WHerrin TMadigan DVasavanonda SLyons NMolla ASaldivar AMarsh KCMcDonald EWideburg NEDenissen JFRobins TKempf DJPlattner JJNorbeck DW A novel, picomolar inhibitor of human immunodeficiency virus type 1 protease. J Med Chem 39:392-7 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM192
fluorogenic peptide substrate
Name:fluorogenic peptide substrate
Synonyms:n/a
Type:fluorogenic peptide
Mol. Mass.:3550.86
Organism:n/a
Description:n/a
Residue:33
Sequence:
DABCYL-GABASer-Gln-Tyr-Pro-Ile-Val-Gln-EDANS