Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM195 |
---|
Substrate/Competitor | fluorogenic peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 4.7±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 0.062±n/a nM |
---|
Comments | |
---|
Citation | Sham, HL; Zhao, C; Stewart, KD; Betebenner, DA; Lin, S; Park, CH; Kong, XP; Rosenbrook, W; Herrin, T; Madigan, D; Vasavanonda, S; Lyons, N; Molla, A; Saldivar, A; Marsh, KC; McDonald, E; Wideburg, NE; Denissen, JF; Robins, T; Kempf, DJ; Plattner, JJ; Norbeck, DW A novel, picomolar inhibitor of human immunodeficiency virus type 1 protease. J Med Chem39:392-7 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM195 |
---|
fluorogenic peptide substrate |
---|
Name: | fluorogenic peptide substrate |
Synonyms: | n/a |
Type: | fluorogenic peptide |
Mol. Mass.: | 3550.86 |
Organism: | n/a |
Description: | n/a |
Residue: | 33 |
Sequence: | DABCYL-GABASer-Gln-Tyr-Pro-Ile-Val-Gln-EDANS
|
|
|