Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain-2
LigandBDBM25895
Substrate/CompetitorBODIPY FL casein
Meas. Tech.BODIPY Fluorescent Microplate Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 140±n/a nM
Citation Jones MAMorton JDCoxon JMMcNabb SBLee HYAitken SGMehrtens JMRobertson LJNeffe ATMiyamoto SBickerstaffe RGately KWood JMAbell AD Synthesis, biological evaluation and molecular modelling of N-heterocyclic dipeptide aldehydes as selective calpain inhibitors. Bioorg Med Chem 16:6911-23 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Calpain-2
Name:Calpain-2
Synonyms:Calpain II 80 kDa subunit | o-CAPN2
Type:Enzyme
Mol. Mass.:79914.19
Organism:Ovis aries (sheep)
Description:A8IF71
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHERAVKYLNQDYAALRDECLEAGALFQDPSFPALPSSLGF
KELGPYSSKTRGIEWKRPTEICDDPQFITGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKAPPNLFRIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDN
CPNWNTVDPEVRESLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEEFTGQTNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPG
EYIVVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEIEANLEEIDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEAAGFKMPCQLHQVIVARFADDDLIIDFD
NFVRCLIRLETLFRIFKQLDPENTGMIQLDLISWLCFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25895
BODIPY FL casein
Name:BODIPY FL casein
Synonyms:4,4-difluoro-5,7-dimethyl-4-bora-3a,4adiaza-s-indacene-3-propionic acid (BODIPY-FL) labeled casein
Type:fluorescent dye-labeled substrate
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a