Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM10882
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki>200000±n/a nM
Citation Temperini CCecchi AScozzafava ASupuran CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett 18:2567-73 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10882
BDBM10856
NameBDBM10882
Synonyms:6-ethoxy-1,3-benzothiazole-2-sulfonamide | CHEMBL18 | Ethamide | Ethoxazolamide | Ethoxzolamide | Ethoxzolamide (EZA) | Ethoxzolamide, EZM | Sulfonamide, 3 | US10172837, Ethoxyzolamide | sulfonamide 3
TypeSmall organic molecule
Emp. Form.C9H10N2O3S2
Mol. Mass.258.317
SMILESCCOc1ccc2nc(sc2c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: