| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 5A, mitochondrial |
|---|
| Ligand | BDBM25899 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| Ki | 750±n/a nM |
|---|
| Citation |  Temperini, C; Cecchi, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett18:2567-73 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 5A, mitochondrial |
|---|
| Name: | Carbonic anhydrase 5A, mitochondrial |
|---|
| Synonyms: | CA-VA | CA5 | CA5A | CAH5A_HUMAN | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34755.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human (cloned) isozyme |
|---|
| Residue: | 305 |
|---|
| Sequence: | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
|
|
|
|---|
| BDBM25899 |
|---|
| BDBM10856 |
|---|
| Name | BDBM25899 |
|---|
| Synonyms: | 7-chloro-2-methyl-3-(2-methylphenyl)-4-oxo-1,2,3,4-tetrahydroquinazoline-6-sulfonamide | Diulo | Metolazone | Microx | Zaroxolyn |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16ClN3O3S |
|---|
| Mol. Mass. | 365.835 |
|---|
| SMILES | CC1Nc2cc(Cl)c(cc2C(=O)N1c1ccccc1C)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
